PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G200400.1
Common NamePHAVU_008G200400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 488aa    MW: 55035.2 Da    PI: 7.5488
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G200400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-192075257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        +kR   t+ ql++Le+++++++yp++e++ eLA++lgLte+q++ WF+ rR k+k+
  Phvul.008G200400.1 20 KKRKLKTPAQLTALEKFYNEHKYPTEEMKLELAEELGLTEKQISGWFCHRRLKDKR 75
                        89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-22275IPR009057Homeodomain-like
PROSITE profilePS5007117.7181676IPR001356Homeobox domain
SuperFamilySSF466896.42E-191883IPR009057Homeodomain-like
SMARTSM003897.5E-211880IPR001356Homeobox domain
PfamPF000464.2E-172075IPR001356Homeobox domain
CDDcd000863.65E-182075No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MEESSELQSE ENKVSNEKNK KRKLKTPAQL TALEKFYNEH KYPTEEMKLE LAEELGLTEK  60
QISGWFCHRR LKDKRLMKDE AVANGRQDRS SGVIQDRGSG LGQDSCGSSK HADYRYLDPK  120
EVESHGFYNH EISVADMTQR RRNRYPENVS GVDDTSSESS SFLQGRAFAQ GQDPYDMEPS  180
RHLTPNGALP PLNPKGAVNM GYKPSGYLKV KGEIEHAAIT AVKKQLGRHY EEDGPLLGIE  240
FDQLPPGAFE CQTEDPANEP FCVANPPLLN SPEISAAKKP NLSSRYDSHY TKFNSQDLHM  300
GADFGSLHES DFQDKQEKKA LKNIKHRQPF YGYTTHVSGR TPFPDLYEDS TGEASGYNSA  360
KNHRMSYKHG VEGMRSDSAS NHSDHFEEKL AVKPKDLMLH GYDKINTKRI QRSGHVKSKP  420
SSSIRNSRVH MDTEERGLSA RMGKQEMFKV DQKAKNTYRD VDGAGRLSNE IMSLQSELKL  480
TCFNNTM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141490.10.0hypothetical protein PHAVU_008G200400g
TrEMBLV7B6N70.0V7B6N7_PHAVU; Uncharacterized protein
STRINGGLYMA14G03850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.18e-72HB-other family protein